thepeoplesgym #thepeoplesgym Instagram Hashtag

Congratulations to our wonderful client @julesr2009 who in the last 20 weeks has lost 13.8kgs and 40.5cm around her body! It shows what commitment and a balanced diet can really do! Well done Jules you are an inspiration to others around you, keep it up 🙌🏼.

Congratulations to our wonderful client @julesr2009 who in the last 20 weeks has lost 13.8kgs and 40.5cm around her body! It shows what commitment and a balanced diet can really do! Well done Jules you are an inspiration to others around you, keep it up 🙌🏼.

43 likes - 43 comments
Are you ready to earn your Christmas treats? 🍫 .
Here's some #MondayMotivation for you 🎄 .

Tag a friend to remind them ✨
.
#ChangingLives #ThePeoplesGym #MyYellowGym #FitnessMotivation

Are you ready to earn your Christmas treats? 🍫 . Here's some #MondayMotivation for you 🎄 . Tag a friend to remind them ✨ . #ChangingLives #ThePeoplesGym #MyYellowGym #FitnessMotivation

34 likes - 34 comments
Fitness testing complete ✔️ Well done to all Revolution members, not only over the past 6 weeks but the whole year! You guys deserve all of the results that you get. Let’s finish the rest of the year off the way we have performed all year! 🏋🏼‍♀️

Fitness testing complete ✔️ Well done to all Revolution members, not only over the past 6 weeks but the whole year! You guys deserve all of the results that you get. Let’s finish the rest of the year off the way we have performed all year! 🏋🏼‍♀️

33 likes - 33 comments
Two amazingly committed young ladies (Lauren & Faith) both in for extra work today ahead of Sortaksin's junior show next Saturday... Both girls worked hard in a tough session today! Next Saturday will be the last weekend of fights for Black Diamond in 2018 in what has been a very successful year for us! 🏴💎 #blackdiamond #muaythai #thaiboxing #building4thefuture #aintnostoppinus #thepeoplesgym

Two amazingly committed young ladies (Lauren & Faith) both in for extra work today ahead of Sortaksin's junior show next Saturday... Both girls worked hard in a tough session today! Next Saturday will be the last weekend of fights for Black Diamond in 2018 in what has been a very successful year for us! 🏴💎 #blackdiamond #muaythai #thaiboxing #building4thefuture #aintnostoppinus #thepeoplesgym

32 likes - 32 comments
Plant based eating is becoming a lot more prominent in society and a lot more restaurants are serving plant based meals, which we think is great! ⭐ .
Here are just a few of the health benefits from this kind of diet, even just introducing a few plant based meals into your balanced diet would be beneficial, why not give it a try! 🌽 .
#Xercise4Less #ChangingLives #ThePeoplesGym #MyYellowGym

Plant based eating is becoming a lot more prominent in society and a lot more restaurants are serving plant based meals, which we think is great! ⭐ . Here are just a few of the health benefits from this kind of diet, even just introducing a few plant based meals into your balanced diet would be beneficial, why not give it a try! 🌽 . #Xercise4Less #ChangingLives #ThePeoplesGym #MyYellowGym

61 likes - 61 comments
You won’t find many of us stuck to a piece of cardio equipment...
.
Whether you want to lose weight or gain muscle, lifting weights (resistance training) will be the fastest way to get you there!!!
.
Why? Because muscle requires energy all throughout the day.
.
You could replace half the fat with the same amount of ‘weight’ in muscle and be half the size almost! All while getting to eat more and do less cardio.
.
We know it sounds like a Christmas list from Santa but we promise it works! Let us show you today with a 4-week meal plan subscription with workouts & cardio for only $100 a month! 🌟🌟🌟.
.
You can do it, we can help.
.
#holidayweightloss #goalgainer #achievementhunter #believeinyourselfalways #youcandoittoo .
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3 yes 
@ladyluv805

You won’t find many of us stuck to a piece of cardio equipment... . Whether you want to lose weight or gain muscle, lifting weights (resistance training) will be the fastest way to get you there!!! . Why? Because muscle requires energy all throughout the day. . You could replace half the fat with the same amount of ‘weight’ in muscle and be half the size almost! All while getting to eat more and do less cardio. . We know it sounds like a Christmas list from Santa but we promise it works! Let us show you today with a 4-week meal plan subscription with workouts & cardio for only $100 a month! 🌟🌟🌟. . You can do it, we can help. . #holidayweightloss #goalgainer #achievementhunter #believeinyourselfalways #youcandoittoo . . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3 yes @ladyluv805

60 likes - 60 comments
Happy Sunday 🌞
.
Thank you for sharing this with us @_Jessikafitness 
Jessica likes to have this as a post workout meal, so eggs and avocado aren't just for breakfast time! 🥑
.
1/2 of an avocado, 2 slices of gluten free toast and 2 scrambled eggs.😊 #Xercise4Less #MyYellowGym #ThePeoplesGym #ChangingLives

Happy Sunday 🌞 . Thank you for sharing this with us @_Jessikafitness Jessica likes to have this as a post workout meal, so eggs and avocado aren't just for breakfast time! 🥑 . 1/2 of an avocado, 2 slices of gluten free toast and 2 scrambled eggs.😊 #Xercise4Less #MyYellowGym #ThePeoplesGym #ChangingLives

43 likes - 43 comments
1 hand up if you could make this look as easy as @tarukalenov has? 🤚
⠀⠀⠀⠀⠀⠀⠀⠀⠀
2 hands up if you don’t even want to try as you know you will pull a muscle! 🤣🤚🤚
⠀⠀⠀⠀⠀⠀⠀⠀⠀
#GymNation #GymNationDXB #GymNationUAE #ThePeoplesGym #uae #dubaigyms #dxb #dxbfitness #mydubai #fitdubai #dubaifitness #dubaifit #mydxb #dubaifitfam #uaefitness #dubailife #fitnessindxb #dubaifitfamily #dubaigym #dubaigyms #uae #gymdubai #dubaiinstagram

1 hand up if you could make this look as easy as @tarukalenov has? 🤚 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ 2 hands up if you don’t even want to try as you know you will pull a muscle! 🤣🤚🤚 ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #GymNation #GymNationDXB #GymNationUAE #ThePeoplesGym #uae #dubaigyms #dxb #dxbfitness #mydubai #fitdubai #dubaifitness #dubaifit #mydxb #dubaifitfam #uaefitness #dubailife #fitnessindxb #dubaifitfamily #dubaigym #dubaigyms #uae #gymdubai #dubaiinstagram

400 likes - 400 comments
I know most of y’all are getting tired of these booty pose pics! Lol some of you probably think I only go to the gym just to take pictures 😂 don’t be a hater ! 
I worked hard as hell to get where my body is so excuse me for celebrating it by taking pictures. Thanks to my parents for giving me some good genes 🧬 
I’m so lucky to have a job that I actually love! Yes, I love makeup with my whole heart but I love fitness just as much! At @bsffitnesscenter I get the support & love I need to keep on bettering myself! 
Come by & check us out at our new location in Ventura 💁🏽‍♀️. See why we are #thepeoplesgym ! 
#fitness #fitchick #slimthicc #buildabootycenter #cantstop #wontstop #gainsville #bootypose #bootybepoppin #bsf

I know most of y’all are getting tired of these booty pose pics! Lol some of you probably think I only go to the gym just to take pictures 😂 don’t be a hater ! I worked hard as hell to get where my body is so excuse me for celebrating it by taking pictures. Thanks to my parents for giving me some good genes 🧬 I’m so lucky to have a job that I actually love! Yes, I love makeup with my whole heart but I love fitness just as much! At @bsffitnesscenter I get the support & love I need to keep on bettering myself! Come by & check us out at our new location in Ventura 💁🏽‍♀️. See why we are #thepeoplesgym ! #fitness #fitchick #slimthicc #buildabootycenter #cantstop #wontstop #gainsville #bootypose #bootybepoppin #bsf

169 likes - 169 comments
Rules for health. 💛

#Xercise4Less #MyYellowGym #ThePeoplesGym #ChangingLives

Rules for health. 💛 #Xercise4Less #MyYellowGym #ThePeoplesGym #ChangingLives

195 likes - 195 comments
Here's a healthy lunch idea for you... 😋
.
Since it is #SelfcareSaturday we thought this recipe from @sinfreesophia would be perfect. Here's what she said about it:

Here's a healthy lunch idea for you... 😋 . Since it is #SelfcareSaturday we thought this recipe from @sinfreesophia would be perfect. Here's what she said about it: "If you've ever experienced binge eating (most of us have), Bulima or disordered eating, I've found making your meals as simple as possible the best. Don't over complicate meals. Get in the nutrients you need and leave it be. Get in the greens/carbs, add in the protein and top off with fats. At the end of the day you are eating to nourish your body, the enjoyment/taste is just a bonus. Eat mindfully." ✨ ingredients: Spinach, butter beans, vegan pesto, sunflower seeds, sundries tomatoes, pomegranate #SelfcareSaturday #Xercise4Less #ThePeoplesGym #MyYellowGym #ChangingLives #HealthyLifestyle #HealthyChoices

26 likes - 26 comments
Hey ladies...
.
.
Tired of the boys having all the fun in the weight room? Come train at 6am with Lindsey Cohn, Monday thru Friday and start getting in on the fun!.
.
🌟SPOTS WILL BE LIMITED TO 10 AND ON A 1ST COME 1ST SERVE BASIS🌟.
.
Classes start January 2019 and will be held at BSF Fitness at 6am. Classes are $100 per week or $385 per month. Meal plan clients will also receive an additional discount.
.
Sign up at the front desk or DM us to reserve your spot today!.
.
.
#bootcampsthatwork #morningmadness #smallgroupclasses #limitedavailability #newyearnewyou.
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3 
@ladyluv805

Hey ladies... . . Tired of the boys having all the fun in the weight room? Come train at 6am with Lindsey Cohn, Monday thru Friday and start getting in on the fun!. . 🌟SPOTS WILL BE LIMITED TO 10 AND ON A 1ST COME 1ST SERVE BASIS🌟. . Classes start January 2019 and will be held at BSF Fitness at 6am. Classes are $100 per week or $385 per month. Meal plan clients will also receive an additional discount. . Sign up at the front desk or DM us to reserve your spot today!. . . #bootcampsthatwork #morningmadness #smallgroupclasses #limitedavailability #newyearnewyou. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3 @ladyluv805

67 likes - 67 comments
Good things come to those who wait...
.
Screw that, good things come to those who work their butts off for what they want in life!.
.
Why are you waiting?.
.
What are you really waiting for?.
.
Or is it maybe the fear of failing?.
.
Or do yo maybe deep down believe ‘it’ won’t work for you? You just weren’t meant to be ‘Great’?.
.
Whatever you hold in your mind on a consistent basis about yourself, your life, your situation, will be exactly what you will experience - you will self-sabotage until what you truly believe comes into fruition.
.
These members have chosen to believe the best of themselves.
.
They are human so the fear of inadequacy is not unknown to them.
.
But they continue to come anyway -determined to prevail over the daily obstacles that give us all valid excuses to stay home.
.
Rain or shine, they came.
.
Thank you for your dedication and perseverance despite life’s ups and downs. It is a reminder to others that we do not have to live dependent upon our circumstances and we can choose a better life, a better body, better health, better everything!.
.
As a thank you, please grab a FREE drink from the front desk of your choice! Your hard work does not go unnoticed and we appreciate you including BSF in your journey and as apart of your family! Please pick up by next Thursday, December 13th.
.
Want to be mentioned in our next #flexitfriday post? TAG BSF in your story or post on IG or Facebook! 🌟.
.
.
#absshinebetterintherain #workingonourfitness #heavyhitters #changemakers #checkintowin.
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3 
@ladyluv805

Good things come to those who wait... . Screw that, good things come to those who work their butts off for what they want in life!. . Why are you waiting?. . What are you really waiting for?. . Or is it maybe the fear of failing?. . Or do yo maybe deep down believe ‘it’ won’t work for you? You just weren’t meant to be ‘Great’?. . Whatever you hold in your mind on a consistent basis about yourself, your life, your situation, will be exactly what you will experience - you will self-sabotage until what you truly believe comes into fruition. . These members have chosen to believe the best of themselves. . They are human so the fear of inadequacy is not unknown to them. . But they continue to come anyway -determined to prevail over the daily obstacles that give us all valid excuses to stay home. . Rain or shine, they came. . Thank you for your dedication and perseverance despite life’s ups and downs. It is a reminder to others that we do not have to live dependent upon our circumstances and we can choose a better life, a better body, better health, better everything!. . As a thank you, please grab a FREE drink from the front desk of your choice! Your hard work does not go unnoticed and we appreciate you including BSF in your journey and as apart of your family! Please pick up by next Thursday, December 13th. . Want to be mentioned in our next #flexitfriday post? TAG BSF in your story or post on IG or Facebook! 🌟. . . #absshinebetterintherain #workingonourfitness #heavyhitters #changemakers #checkintowin. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3 @ladyluv805

68 likes - 68 comments
I've not posted a short video in a while, but after watching Lauren progress so well lately, I feel it was right to post something... Lauren's one of my longest serving juniors & also most committed too. The beginning of 2018 was a bit of a shaky start for Lauren, but after a break from competing she's ready to step back in the ring again. Sometimes having a break away from such a demanding ring sport such as Muay Thai can be a good thing both mentally & physically. Just getting back to basics in the gym without the added pressure of fighting can help you rediscovered your form & hunger for when you decide the time is right to put on your dancing shoes again. I've seen great changes in Lauren lately & I can't wait to see what 2019 brings for her! 🏴💎 #blackdiamond #muaythai #thaiboxing #building4thefuture #aintnostoppinus #thepeoplesgym

I've not posted a short video in a while, but after watching Lauren progress so well lately, I feel it was right to post something... Lauren's one of my longest serving juniors & also most committed too. The beginning of 2018 was a bit of a shaky start for Lauren, but after a break from competing she's ready to step back in the ring again. Sometimes having a break away from such a demanding ring sport such as Muay Thai can be a good thing both mentally & physically. Just getting back to basics in the gym without the added pressure of fighting can help you rediscovered your form & hunger for when you decide the time is right to put on your dancing shoes again. I've seen great changes in Lauren lately & I can't wait to see what 2019 brings for her! 🏴💎 #blackdiamond #muaythai #thaiboxing #building4thefuture #aintnostoppinus #thepeoplesgym

33 likes - 33 comments
It’s been a crazy 6 months since we opened and to top it all off we won the @sport360 Fit Awards

It’s been a crazy 6 months since we opened and to top it all off we won the @sport360 Fit Awards "Independent Facility Of The Year" Award on Wednesday night! ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Thank you for all the ongoing support from everyone @gymnation_uae ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #GymNation #GymNationDXB #GymNationUAE #ThePeoplesGym #uae #dubaigyms #dxb #dxbfitness #mydubai #fitdubai #dubaifitness #dubaifit #mydxb #dubaifitfam #uaefitness #dubailife #fitnessindxb #dubaifitfamily #dubaigym #dubaigyms #uae #gymdubai #dubaiinstagram #sport360 #fitness #dubaifitawards #sport360 #dubaimuscleshow #dubaiactiveshow

300 likes - 300 comments
It’s been a crazy 6 months since we opened and to top it all off we won the @sport360 Fit Awards

It’s been a crazy 6 months since we opened and to top it all off we won the @sport360 Fit Awards "Independent Facility Of The Year" Award on Wednesday night! ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Thank you for all the ongoing support from everyone @gymnation_uae ⠀⠀⠀⠀⠀⠀⠀⠀⠀ Who is excited to see more @gymnation_uae locations opening in 2019 and where would you like to see them open? ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #GymNation #GymNationDXB #GymNationUAE #ThePeoplesGym #uae #dubaigyms #dxb #dxbfitness #mydubai #fitdubai #dubaifitness #dubaifit #mydxb #dubaifitfam #uaefitness #dubailife #fitnessindxb #dubaifitfamily #dubaigym #dubaigyms #uae #gymdubai #dubaiinstagram #sport360 #fitness #dubaifitawards #sport360 #dubaimuscleshow #dubaiactiveshow

488 likes - 488 comments
Once you see results, it becomes an addiction ✨ #ThursdayThoughts .
What results do you hope to see in a years time? 🎯 .
Comment below 👇
.
#ChangingLives #ThePeoplesGym #MyYellowGym #Xercise4Less #ThursdayQuotes #FitnessMotivation #GymTime

Once you see results, it becomes an addiction ✨ #ThursdayThoughts . What results do you hope to see in a years time? 🎯 . Comment below 👇 . #ChangingLives #ThePeoplesGym #MyYellowGym #Xercise4Less #ThursdayQuotes #FitnessMotivation #GymTime

132 likes - 132 comments
BodyPump is a resistance workout scientifically proven to help you achieve long lasting results, fast 🏋️ .
Book your space today! Click the link on our story now ⌛
.
#ChangingLives #ThePeoplesGym #MyYellowGym #Xercise4Less #GymTime #FitFam #FitnessMotivation

BodyPump is a resistance workout scientifically proven to help you achieve long lasting results, fast 🏋️ . Book your space today! Click the link on our story now ⌛ . #ChangingLives #ThePeoplesGym #MyYellowGym #Xercise4Less #GymTime #FitFam #FitnessMotivation

49 likes - 49 comments
2019 will see Black Diamond become BIGGER, BETTER & STRONGER... There's some big changes on the horizon - changes for the better 🏴💎 #blackdiamond #biggerbetterstronger #building4thefuture #aintnostoppinus #thepeoplesgym #2019

2019 will see Black Diamond become BIGGER, BETTER & STRONGER... There's some big changes on the horizon - changes for the better 🏴💎 #blackdiamond #biggerbetterstronger #building4thefuture #aintnostoppinus #thepeoplesgym #2019

30 likes - 30 comments
3 WAYS TO FINDING YOUR INNER GODDESS, AGAIN (Guys, you could use this too...🤫🤣) #betterliving.
.
.
1) STOP LOSING YOURSELF TRYING TO PLEASE OTHERS.
This seems like a given but it is easier said then done. We are supposed to be people that love and care about others, willing to give when asked of. But that does not mean we choose another’s happiness over what God has called us to do. Be willing to say no to others when it compromises who you are, what you stand for, or your ability to carry out a life that God is calling you to live 🌟.
.
2) BE WILLING TO LOSE THE ‘LOVE’ OF OTHERS.
You’ve heard it a thousand times over by now: “those that mind don’t matter and those that matter don’t mind”. Well, in a sense that’s true! If you are pursuing goals and dreams that are healthy, fulfilling and life-giving, others should be encouraging your journey, not criticizing it...and if they are, they aren’t really ‘loving’ you. Be willing to let those like this remove themselves from your life 💛.
.
3) BE WILLING TO GIVE UP THAT ‘THING’.
We all have ‘things’ difficult to let go of...many of them we won’t recognize have such a hold on our life until we are asked to let go of them. Just like with people, you must not remain captive to things that are not conducive to your goals 🤩.
.
.
Need more? We’ve got TONS! 🤗✨ DM US TODAY, and we’d be happy to help you along your journey in any way we can.
.
.
#findyourfreedom #findyourinnerpeace #goddesses #livelikenooneelse #freedoms.
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3

3 WAYS TO FINDING YOUR INNER GODDESS, AGAIN (Guys, you could use this too...🤫🤣) #betterliving. . . 1) STOP LOSING YOURSELF TRYING TO PLEASE OTHERS. This seems like a given but it is easier said then done. We are supposed to be people that love and care about others, willing to give when asked of. But that does not mean we choose another’s happiness over what God has called us to do. Be willing to say no to others when it compromises who you are, what you stand for, or your ability to carry out a life that God is calling you to live 🌟. . 2) BE WILLING TO LOSE THE ‘LOVE’ OF OTHERS. You’ve heard it a thousand times over by now: “those that mind don’t matter and those that matter don’t mind”. Well, in a sense that’s true! If you are pursuing goals and dreams that are healthy, fulfilling and life-giving, others should be encouraging your journey, not criticizing it...and if they are, they aren’t really ‘loving’ you. Be willing to let those like this remove themselves from your life 💛. . 3) BE WILLING TO GIVE UP THAT ‘THING’. We all have ‘things’ difficult to let go of...many of them we won’t recognize have such a hold on our life until we are asked to let go of them. Just like with people, you must not remain captive to things that are not conducive to your goals 🤩. . . Need more? We’ve got TONS! 🤗✨ DM US TODAY, and we’d be happy to help you along your journey in any way we can. . . #findyourfreedom #findyourinnerpeace #goddesses #livelikenooneelse #freedoms. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3

51 likes - 51 comments

"The pain you feel today will be the strength you feel tomorrow" ✨ . Who made it to the gym tonight for #WorkoutWednesday? 🏋️ . Let us know what you trained in the comments 👇 . Credit: @itssamcallahan . #ThePeoplesGym #ChangingLives #FitFam #Xercise4Less #GymTime #Fitspo #InstaFit #WorkoutWednesday

82 likes - 82 comments
Ride it like you stole it at our #Cycle4FiiT class! 🚲 .
Not a member? Sign up for an Xercise4Less peak membership for only £15.99pm today! ✨ .

For more information, head to our story now ⌛
.
#healthylifestyle #changinglives #fitnesslife #xercise4less #fitnessmotivation #thepeoplesgym #myyellowgym

Ride it like you stole it at our #Cycle4FiiT class! 🚲 . Not a member? Sign up for an Xercise4Less peak membership for only £15.99pm today! ✨ . For more information, head to our story now ⌛ . #healthylifestyle #changinglives #fitnesslife #xercise4less #fitnessmotivation #thepeoplesgym #myyellowgym

34 likes - 34 comments
“Wait” is a word for the weary.
.
“Wait” is the crutch of the coward.
.
“Wait” is a silent assassin.
.
“Wait” kills the hope of a future.
.
Stopping waiting. Start doing.
.
We won’t lie to you and say the road is free from pot holes and detours.
.
In fact, quite often resistance is thrown relentlessly at the very person who is about to succeed at something Great - this is why movies speak to our hearts and testimonies of others conquering their adversities ignites a light of hope in our own hearts.
.
SO LET US THEN WALK IN CONFIDENCE AS WE DRAW NEAR TO THE THRONE OF GRACE. Hebrews 4:16.
.
.
Let us help you reach your full potential, today! DM US for a FREE 3-Day pass!.
.
.
#conqueryourfears #conqueryourdreams #conqueryourday #betterpeopleproject #thebestornothing #hebrews4v16 #truthquotes.
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3

“Wait” is a word for the weary. . “Wait” is the crutch of the coward. . “Wait” is a silent assassin. . “Wait” kills the hope of a future. . Stopping waiting. Start doing. . We won’t lie to you and say the road is free from pot holes and detours. . In fact, quite often resistance is thrown relentlessly at the very person who is about to succeed at something Great - this is why movies speak to our hearts and testimonies of others conquering their adversities ignites a light of hope in our own hearts. . SO LET US THEN WALK IN CONFIDENCE AS WE DRAW NEAR TO THE THRONE OF GRACE. Hebrews 4:16. . . Let us help you reach your full potential, today! DM US for a FREE 3-Day pass!. . . #conqueryourfears #conqueryourdreams #conqueryourday #betterpeopleproject #thebestornothing #hebrews4v16 #truthquotes. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3

45 likes - 45 comments

"Don't watch the clock; Do what it does. Keep going" ⌛ . What did you train these evening to warm up from the cold? ❄️ . #ChangingLives #MyYellowGym #GymLife #ThePeoplesGym #FitFam #InstaGood #TransformationTuesday #TuesdayThoughts

130 likes - 130 comments
It's #TransformationTuesday ✨ .

Feel like you need a extra boost when training? 🏋️ Why not check out our PT sessions? 💪 .

Click the link on our story or for more information comment down below! 👇
.
#ChangingLives #ThePeoplesGym #FitnessMotivation #FitFam #MyYellowGym #GymTime

It's #TransformationTuesday ✨ . Feel like you need a extra boost when training? 🏋️ Why not check out our PT sessions? 💪 . Click the link on our story or for more information comment down below! 👇 . #ChangingLives #ThePeoplesGym #FitnessMotivation #FitFam #MyYellowGym #GymTime

33 likes - 33 comments
My biggest competition stood right there 🥊 
I’ll take you... little muppet you can’t beat me 😂 
#kieranfarrellpromotions #thepeoplesgym #promoter #trainer #manager #boxing #proboxing #boxeo #boxeoprofesional #britishempiremedal

My biggest competition stood right there 🥊 I’ll take you... little muppet you can’t beat me 😂 #kieranfarrellpromotions #thepeoplesgym #promoter #trainer #manager #boxing #proboxing #boxeo #boxeoprofesional #britishempiremedal

557 likes - 557 comments
•Just Do It• ✅💯 ❄️☃️
Like many people I find it so hard to stay motivated when its freezing! But you have to keep going to get where you want to be! Wrap up and stay warm 😘

Wearing @nike @nikewomen @nikesportswear 🙌💪
#fitnessmotivation #fitness #gym #gymmotivation #gymshark #gymsharkwomen #gymlife #training #keepgoing #workout #workhard #workhardplayhard #ass #gains #bootybootybooty #bootygains🍑 #myyellowgym #thepeoplesgym

•Just Do It• ✅💯 ❄️☃️ Like many people I find it so hard to stay motivated when its freezing! But you have to keep going to get where you want to be! Wrap up and stay warm 😘 Wearing @nike @nikewomen @nikesportswear 🙌💪 #fitnessmotivation #fitness #gym #gymmotivation #gymshark #gymsharkwomen #gymlife #training #keepgoing #workout #workhard #workhardplayhard #ass #gains #bootybootybooty #bootygains🍑 #myyellowgym #thepeoplesgym

566 likes - 566 comments
Fall 7 times. Stand up 8. 💪🏼🔥#nevergiveup👊 .
.
.
Learn how to train to see real results from the Pros.
.
After all, you don’t rely on your own knowledge & research to build your house, why would you to build your body?.
.
Or a better question, if what you’ve done hasn’t worked in the past, what have you got to lose?.
.
Want to try it out? Drop in for a workout for only $10 for current members, $20 for Guests!.
.
.
#thebestofthebest #thebestofthegym #trainwithapro #tobethebesttrainwiththebest #betterpeopleproject.
.

#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfventura #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3

Fall 7 times. Stand up 8. 💪🏼🔥#nevergiveup👊 . . . Learn how to train to see real results from the Pros. . After all, you don’t rely on your own knowledge & research to build your house, why would you to build your body?. . Or a better question, if what you’ve done hasn’t worked in the past, what have you got to lose?. . Want to try it out? Drop in for a workout for only $10 for current members, $20 for Guests!. . . #thebestofthebest #thebestofthegym #trainwithapro #tobethebesttrainwiththebest #betterpeopleproject. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfventura #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3

47 likes - 47 comments
Another good push @ S7 this past week.. Great work from D&O Construction and architect Nick James with delivering first floor sheeting in preparation for the concrete 💪🏻 #thepeoplesgym #selfmadegymsmakeselfmadewinners #everythinginonefacility

Another good push @ S7 this past week.. Great work from D&O Construction and architect Nick James with delivering first floor sheeting in preparation for the concrete 💪🏻 #thepeoplesgym #selfmadegymsmakeselfmadewinners #everythinginonefacility

80 likes - 80 comments
What week of camp are you on this week? 💪 .
Let us know in the comments below, we'd love to hear your progress 🏋️
.
#ChangingLives #ThePeoplesGym #Xercise4Less #MyYellowGym #MondayMotivation #FitFam

What week of camp are you on this week? 💪 . Let us know in the comments below, we'd love to hear your progress 🏋️ . #ChangingLives #ThePeoplesGym #Xercise4Less #MyYellowGym #MondayMotivation #FitFam

42 likes - 42 comments
#kombatsback 🥊⚔️ First session at #thepeoplesgym as a new daddy 🥊 Good session in with @kieran_farrell_bem and @thebeast_fromtheast

#kombatsback 🥊⚔️ First session at #thepeoplesgym as a new daddy 🥊 Good session in with @kieran_farrell_bem and @thebeast_fromtheast

13 likes - 13 comments
Vote on our story page- closes midnight tonight! #gym #jukebox #the #peoples #gym #sutton #thepeoplesgym

Vote on our story page- closes midnight tonight! #gym #jukebox #the #peoples #gym #sutton #thepeoplesgym

14 likes - 14 comments
Monday feel goods 😊😊😊
Thanks James so good to get positive feedback and hear you enjoy the place. 
Happy Monday everybody ☺🤙 #positivevibes #gymismytherapy #gymforlife #thepeoplesgym #gymmotivation #gyms #gym

Monday feel goods 😊😊😊 Thanks James so good to get positive feedback and hear you enjoy the place. Happy Monday everybody ☺🤙 #positivevibes #gymismytherapy #gymforlife #thepeoplesgym #gymmotivation #gyms #gym

29 likes - 29 comments
Our members are loving the transformation camps so far! 🙌
.
Let us know how you are getting on in your transformation camp in the comments below... 👇
.
#xercise4less #myyellowgym #thepeoplesgym #changinglives

Our members are loving the transformation camps so far! 🙌 . Let us know how you are getting on in your transformation camp in the comments below... 👇 . #xercise4less #myyellowgym #thepeoplesgym #changinglives

35 likes - 35 comments
#Repost @tomreesfitness
. . .
Big up to my transformation crew for smashing it tonight 💪 can't believe another camp is coming to an end... hope you all enjoyed watching me squirm, cardio is definitely not my strong suit anymore 😂

#Xercise4Less #ChangingLives #MyYellowGym #ThePeoplesGym #SundaySession #SundaySuccess

#Repost @tomreesfitness . . . Big up to my transformation crew for smashing it tonight 💪 can't believe another camp is coming to an end... hope you all enjoyed watching me squirm, cardio is definitely not my strong suit anymore 😂 #Xercise4Less #ChangingLives #MyYellowGym #ThePeoplesGym #SundaySession #SundaySuccess

50 likes - 50 comments
#Repost @jessicasn_fit
・・・
ITS THE WEEKEND!!!! How you all doing ? Who else kick started there weekend with a great workout! Woke up this morning felt really motivated and ready to go. I completed a glutes workout which included some of my favourite exercises 🔥👀 Just remember you are strong , beautiful and individual, dream big and lift bigger 💪🏻💪🏻 1️⃣ single leg side kicks and kick backs 
2️⃣ Kneeled squats 
3️⃣ Dumbbell hamstring curl 
4️⃣ Straight leg deadlift 
5️⃣ Feet front facing squat
6️⃣ Frog pumps 
7️⃣ Feet facing outwards squat 
#xercise4less #changinglives #thepeoplesgym #myyellowgym

#Repost @jessicasn_fit ・・・ ITS THE WEEKEND!!!! How you all doing ? Who else kick started there weekend with a great workout! Woke up this morning felt really motivated and ready to go. I completed a glutes workout which included some of my favourite exercises 🔥👀 Just remember you are strong , beautiful and individual, dream big and lift bigger 💪🏻💪🏻 1️⃣ single leg side kicks and kick backs 2️⃣ Kneeled squats 3️⃣ Dumbbell hamstring curl 4️⃣ Straight leg deadlift 5️⃣ Feet front facing squat 6️⃣ Frog pumps 7️⃣ Feet facing outwards squat #xercise4less #changinglives #thepeoplesgym #myyellowgym

25 likes - 25 comments
Haven’t been able to squat in ages due to a knee injury so getting back up to squatting at 45kg is an achievement for me 🙌🏻 Didn’t get a video of that but here’s the 40kg set @xercise4less @x4l_chesterfield 🙌🏻💪🏼
#squats #40kg #45kg #afterinjury #gym #gymobsessed #squatsquatsquat #weights #betteryourself #loveyourself #gettingstronger #workingonme #girlswhosquat #buildingstrength #slowlybutsurely #xercise4less #chesterfield #gymsession #withthehubby #couplesthatworkout #thepeoplesgym #myyellowgym

Haven’t been able to squat in ages due to a knee injury so getting back up to squatting at 45kg is an achievement for me 🙌🏻 Didn’t get a video of that but here’s the 40kg set @xercise4less @x4l_chesterfield 🙌🏻💪🏼 #squats #40kg #45kg #afterinjury #gym #gymobsessed #squatsquatsquat #weights #betteryourself #loveyourself #gettingstronger #workingonme #girlswhosquat #buildingstrength #slowlybutsurely #xercise4less #chesterfield #gymsession #withthehubby #couplesthatworkout #thepeoplesgym #myyellowgym

23 likes - 23 comments
Meal prep fans, this is one for you! 😃
.
Wild Alaskan salmon fillet cooked at 180 for 15 minutes, roasted cherry tomatoes & peas, with green beans and finally glazed with balsamic. .
This easy, low calorie recipe is courtesy of @_jessikafitness ⭐

#Xercise4Less #changinglives #myyellowgym #thepeoplesgym #selfcaresaturday

Meal prep fans, this is one for you! 😃 . Wild Alaskan salmon fillet cooked at 180 for 15 minutes, roasted cherry tomatoes & peas, with green beans and finally glazed with balsamic. . This easy, low calorie recipe is courtesy of @_jessikafitness #Xercise4Less #changinglives #myyellowgym #thepeoplesgym #selfcaresaturday

47 likes - 47 comments
You can’t do beautiful things with crappy people. That’s why we hire and keep only the BEST. #betterpeopleproject 🌟.
.
We are excited to welcome Alex Puga 👉🏼 @bitchin_blu3 back to the #BSFTeam!.
.
Many of you may know Alex when she worked at our old location in Hueneme, or have seen her kicking ass in the gym at the new location! 🔥💪🏼.
.
Please give her a FOLLOW and a warm hello when you see her. She is one of many we were sad to see move on in the past but God always has a way of bringing great people back together at the perfect time! 😏❤️.
.
We love you, Alex! We are are so happy you are back as apart of the team again! 💛🖤💛🖤.
.
#ourfitfam #greatnessawaits #epicteam #surroundyourselfwithgoodpeople #teamworkmakesthedreamwork💯.
.
#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3

You can’t do beautiful things with crappy people. That’s why we hire and keep only the BEST. #betterpeopleproject 🌟. . We are excited to welcome Alex Puga 👉🏼 @bitchin_blu3 back to the #BSFTeam!. . Many of you may know Alex when she worked at our old location in Hueneme, or have seen her kicking ass in the gym at the new location! 🔥💪🏼. . Please give her a FOLLOW and a warm hello when you see her. She is one of many we were sad to see move on in the past but God always has a way of bringing great people back together at the perfect time! 😏❤️. . We love you, Alex! We are are so happy you are back as apart of the team again! 💛🖤💛🖤. . #ourfitfam #greatnessawaits #epicteam #surroundyourselfwithgoodpeople #teamworkmakesthedreamwork💯. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturagym #caligym #californiafitness #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3

63 likes - 63 comments
Weekends are not weak ends! ⭐
.
Don't give up just because its the weekend, summer bodies are made in the winter! 😋
.
#Xercise4Less #ChangingLives #ThePeoplesGym #MyYellowGym

Weekends are not weak ends! ⭐ . Don't give up just because its the weekend, summer bodies are made in the winter! 😋 . #Xercise4Less #ChangingLives #ThePeoplesGym #MyYellowGym

55 likes - 55 comments
BUSTIN’ A MOVE.  @braydanfender testing his new Ultimate Squat Shorts out with a pre WOD boogie!! #bullittfitgear #bfg #bullittproof #bullitt #allstaralliance #crossfit #crossfitaustralia #squat #dance #wodshorts #athlete #thepeoplesgym

BUSTIN’ A MOVE. @braydanfender testing his new Ultimate Squat Shorts out with a pre WOD boogie!! #bullittfitgear #bfg #bullittproof #bullitt #allstaralliance #crossfit #crossfitaustralia #squat #dance #wodshorts #athlete #thepeoplesgym

77 likes - 77 comments
#Repost @scott_hastings_fit
・・・
On Fridays, we flex! 💪🏽 .
#FridayFlex #Xercise4Less #ThePeoplesGym #ChangingLives #MyYellowGym

#Repost @scott_hastings_fit ・・・ On Fridays, we flex! 💪🏽 . #FridayFlex #Xercise4Less #ThePeoplesGym #ChangingLives #MyYellowGym

70 likes - 70 comments
The weekend is finally here, oh yes! 🔥
Don't forget, the grind includes Friday! 💪
Who's working out with us tonight? 😆
.
#ThePeoplesGym #ChangingLives #MyYellowGym #Xercise4Less

The weekend is finally here, oh yes! 🔥 Don't forget, the grind includes Friday! 💪 Who's working out with us tonight? 😆 . #ThePeoplesGym #ChangingLives #MyYellowGym #Xercise4Less

57 likes - 57 comments
Successful people succeed on purpose. #dothework 💯.
.
Successful people are not gifted.
.
Behind the glamor are scars from lessons learned, burns from bridges lost, and stains of relentless sweat.
.
Day in and day out they choose to place the fear of inadequacy behind them, the fear of failure beneath their feet, and the vision of a conqueror in their head.
.
They choose their thoughts wisely knowing negative thoughts are just as debilitating as the very failure we fear.
.
These members proactively choose change despite the discomfort.
.
These members are the true champions.
.
Thank you to those featured in today’s #flexitfriday post by checking in, TAGGING BSF, or sharing your journey on your stories!.
.
You are motivating so many with your posts and we want to encourage more of that so please enjoy a FREE drink of your choice next time you come in (which will probably be today knowing you all! 😏).
.
Please show this message to the front desk by Thursday, December 6th to receive your FREE DRINK 🍹!.
.
.
#dedicatedtothepursuit #beaboutit #beyondthelimits #hardworkpaysoffs #examplesetters .
.
#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter
.
#bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt.
.
#venturaca #ventura #venturacounty #venturasmallbusiness #venturastrong #vta #calistrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas
@bitchin_blu3

Successful people succeed on purpose. #dothework 💯. . Successful people are not gifted. . Behind the glamor are scars from lessons learned, burns from bridges lost, and stains of relentless sweat. . Day in and day out they choose to place the fear of inadequacy behind them, the fear of failure beneath their feet, and the vision of a conqueror in their head. . They choose their thoughts wisely knowing negative thoughts are just as debilitating as the very failure we fear. . These members proactively choose change despite the discomfort. . These members are the true champions. . Thank you to those featured in today’s #flexitfriday post by checking in, TAGGING BSF, or sharing your journey on your stories!. . You are motivating so many with your posts and we want to encourage more of that so please enjoy a FREE drink of your choice next time you come in (which will probably be today knowing you all! 😏). . Please show this message to the front desk by Thursday, December 6th to receive your FREE DRINK 🍹!. . . #dedicatedtothepursuit #beaboutit #beyondthelimits #hardworkpaysoffs #examplesetters . . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym #buildabootycenter . #bsf #bsffitness #bsffitnesscenter #bsfteam #bsffitfam #bsffam #bsfmoms #bsfgirls #bsfbuilt. . #venturaca #ventura #venturacounty #venturasmallbusiness #venturastrong #vta #calistrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas @bitchin_blu3

66 likes - 66 comments
Who attended their second session of the Transformation Camp this evening? 🤸‍♀️ .
Let us know how it went by commenting below 👇.#ThePeoplesGym #ChangingLives #MyYellowGym #FitFam #GymLife #Xercise4Less #ThursdayThoughts

Who attended their second session of the Transformation Camp this evening? 🤸‍♀️ . Let us know how it went by commenting below 👇.#ThePeoplesGym #ChangingLives #MyYellowGym #FitFam #GymLife #Xercise4Less #ThursdayThoughts

67 likes - 67 comments
#ThursdayThoughts ✨ .
It's FriYAY tomorrow, who is going to work hard tonight so they can have indulgent weekend? 💪 .
#ChangingLives #ThePeoplesGym #Xercise4Less #MyYellowGym #GymLife #FitFam #FitnessMotivation

#ThursdayThoughts ✨ . It's FriYAY tomorrow, who is going to work hard tonight so they can have indulgent weekend? 💪 . #ChangingLives #ThePeoplesGym #Xercise4Less #MyYellowGym #GymLife #FitFam #FitnessMotivation

45 likes - 45 comments
Рано или поздно наступает момент,когда ты по привычке тянешься за приправой и вдруг понимаешь,что вкуснее - без. Для красоты не нужна косметика,для веселья -алкоголь,для подарков - повод. Момент упрощения. Жизнь без усилителей вкуса. Но это не сразу.#sportswearforeverywhere #bodytime #goodfood #tobestrong #sportfood #followme #gym #fitness #fitnessforlife #instasports #thepeoplesgym #sportwear #itsmytime

Рано или поздно наступает момент,когда ты по привычке тянешься за приправой и вдруг понимаешь,что вкуснее - без. Для красоты не нужна косметика,для веселья -алкоголь,для подарков - повод. Момент упрощения. Жизнь без усилителей вкуса. Но это не сразу.#sportswearforeverywhere #bodytime #goodfood #tobestrong #sportfood #followme #gym #fitness #fitnessforlife #instasports #thepeoplesgym #sportwear #itsmytime

69 likes - 69 comments
Community OVER Competition 🤝🌟 #becomeapartofsomethinggreater.
.
.
Some just want four walls with machines, designed lotions 🧴 or social hour and so we recognize we are not for everyone.
.
But for those that want to be apart of something great...
.
For those that want to join a movement of positive change...
.
For those that are ready to genuinely tackle their struggles...
.
For those that want to share and invest in one another...
.
For those that want to become Better, Stronger and see Change Faster...
.
Come Join the Movement taking over Ventura.
.
Come see what makes us a #differentbreed.
.
Come see the Vision that is about to become Reality in just a few short months!.
.
Come get grandfathered in at the cheapest rate EVER! (Prices increase December 1st).
.
Come Change Your Life.
.
We are #thepeoplesgym.
.
We are #BSF.
.
DM us today for your FREE 3-day Pass ($30 Value).
.
.
#beaboutit #tistheseasontogive #tistheseasonforchange #positivechanges #betterstrongerfaster.
.
#bestmembersever #championsbledhere #championsbredhere #jointhemovement.
.
#bsffitness #bsffitnesscenter #venturaca #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas

Community OVER Competition 🤝🌟 #becomeapartofsomethinggreater. . . Some just want four walls with machines, designed lotions 🧴 or social hour and so we recognize we are not for everyone. . But for those that want to be apart of something great... . For those that want to join a movement of positive change... . For those that are ready to genuinely tackle their struggles... . For those that want to share and invest in one another... . For those that want to become Better, Stronger and see Change Faster... . Come Join the Movement taking over Ventura. . Come see what makes us a #differentbreed. . Come see the Vision that is about to become Reality in just a few short months!. . Come get grandfathered in at the cheapest rate EVER! (Prices increase December 1st). . Come Change Your Life. . We are #thepeoplesgym. . We are #BSF. . DM us today for your FREE 3-day Pass ($30 Value). . . #beaboutit #tistheseasontogive #tistheseasonforchange #positivechanges #betterstrongerfaster. . #bestmembersever #championsbledhere #championsbredhere #jointhemovement. . #bsffitness #bsffitnesscenter #venturaca #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas

58 likes - 58 comments
#ThePeoplesGym 💪🏻

#ThePeoplesGym 💪🏻

48 likes - 48 comments
#Repost @mellowfitness_ ・・・
Smile! 😄 It’s halfway to Friday 💃
.
What did you train today for #WorkoutWednesday 🏋️‍♀️
. 
#xercise4less #changinglives #fitnessmotivation #fitnesslife #healthylifestyle #thepeoplesgym

#Repost @mellowfitness_ ・・・ Smile! 😄 It’s halfway to Friday 💃 . What did you train today for #WorkoutWednesday 🏋️‍♀️ . #xercise4less #changinglives #fitnessmotivation #fitnesslife #healthylifestyle #thepeoplesgym

50 likes - 50 comments
ClaYmore clothing is moving fast, curtisy of @dktagz. The amount of interest you guyz have shown in repping your gym has been huge & is essential for taking the gym forward.  Let's keep the momentum going & keep hitting those training goals 😁💪👍
-
-
#inittogether #claymoregym #thepeoplesgym #undernewmanagemaent #claymorefam #bodybuilding #powerlifting #strongman #muscle #power #strength #gains #family #olympia #bodypower #onform #usn #dench #gang #followback  #familyatmosphere #formisking #sticktotheplan #tamworth #gym #cardio #freeweights #supplements #girlswholift #powerlifting

ClaYmore clothing is moving fast, curtisy of @dktagz. The amount of interest you guyz have shown in repping your gym has been huge & is essential for taking the gym forward. Let's keep the momentum going & keep hitting those training goals 😁💪👍 - - #inittogether #claymoregym  #thepeoplesgym #undernewmanagemaent #claymorefam #bodybuilding #powerlifting #strongman #muscle #power #strength #gains #family #olympia #bodypower #onform #usn #dench #gang #followback  #familyatmosphere #formisking #sticktotheplan #tamworth #gym #cardio #freeweights #supplements #girlswholift #powerlifting

48 likes - 48 comments
It's #WorkoutWednesday 💪 .
Tag your gym buddy to dare them to try this killer HIIT workout during your session this evening #JustForFun #HIIT 🤸‍♀️ .
#ThePeoplesGym #ChangingLives #Xercise4Less #WednesdayVibes #HumpDay #FitnessMotivation #FitFam

It's #WorkoutWednesday 💪 . Tag your gym buddy to dare them to try this killer HIIT workout during your session this evening #JustForFun #HIIT 🤸‍♀️ . #ThePeoplesGym #ChangingLives #Xercise4Less #WednesdayVibes #HumpDay #FitnessMotivation #FitFam

198 likes - 198 comments
We hope you recover swiftly Laura 💛 .
Our last 8 Week Transformation Camp of the year started today! 🎉 .
Who's excited to see their results in 8 weeks time? 💪 .
Just missed it? Don't worry, you can book your FREE PT consultation now to discuss your options 👏
.
DM us for more information 📨
.
#ChangingLives #ThePeoplesGym #Xercise4Less #GymTime #MyYellowGym #GymMotivation #FitFam #TransformationTuesday

We hope you recover swiftly Laura 💛 . Our last 8 Week Transformation Camp of the year started today! 🎉 . Who's excited to see their results in 8 weeks time? 💪 . Just missed it? Don't worry, you can book your FREE PT consultation now to discuss your options 👏 . DM us for more information 📨 . #ChangingLives #ThePeoplesGym #Xercise4Less #GymTime #MyYellowGym #GymMotivation #FitFam #TransformationTuesday

47 likes - 47 comments
WHAT A GAFF !!!! #thepeoplesgym 👊🏻👊🏻@tommysacademy2

WHAT A GAFF !!!! #thepeoplesgym 👊🏻👊🏻@tommysacademy2

60 likes - 60 comments
MEN’S HEALTH MAGAZINE !!!! Best fitness classes for 2019 👊🏻👊🏻 We have been selected for the UK’s best fitness classes for 2019 by @menshealthuk !! What an achievement for the gym and we couldn’t have done it with out all you guys, thankyou for the continued support and making the gym one of the best gyms in hull. We would love it if we could get as many people down for tomorrow night’s TC60 class which we will be taking the photos which will be used in the article for the magazine 📸 let’s spread the word and fill the gym to the rafters !!!! #TC60 #menshealthmag #thepeoplesgym #hullfitness #coylehealthandwellbeing #gymlife

MEN’S HEALTH MAGAZINE !!!! Best fitness classes for 2019 👊🏻👊🏻 We have been selected for the UK’s best fitness classes for 2019 by @menshealthuk !! What an achievement for the gym and we couldn’t have done it with out all you guys, thankyou for the continued support and making the gym one of the best gyms in hull. We would love it if we could get as many people down for tomorrow night’s TC60 class which we will be taking the photos which will be used in the article for the magazine 📸 let’s spread the word and fill the gym to the rafters !!!! #TC60 #menshealthmag #thepeoplesgym #hullfitness #coylehealthandwellbeing #gymlife

82 likes - 82 comments
The guys and girls from @fittesthumanofficial will be back at @gymnation_uae TONIGHT ‪from 6PM-8PM‬. This is your chance to qualify for the individual rounds @dubaimuscleshow! 
The 2 minute test consists of 30s hurdle jumpovers, 30s max row & 60s goblet squats. Think you are fit? Then come and prove it just like @shima_r93 here!
⠀⠀⠀⠀⠀⠀⠀⠀⠀
#GymNation #GymNationDXB #GymNationUAE #ThePeoplesGym #dubai #dubaigyms #dxb #dxbfitness #fitnessindxb #mydubai #fitdubai #dubaifitness #dubaifit #mydxb #dubaifitfam #fitness #dubailife #dubaifitfamily #dubaigym #dubaievents #dubaimuscleshow #dubaiactiveshow2018

The guys and girls from @fittesthumanofficial will be back at @gymnation_uae TONIGHT ‪from 6PM-8PM‬. This is your chance to qualify for the individual rounds @dubaimuscleshow! The 2 minute test consists of 30s hurdle jumpovers, 30s max row & 60s goblet squats. Think you are fit? Then come and prove it just like @shima_r93 here! ⠀⠀⠀⠀⠀⠀⠀⠀⠀ #GymNation #GymNationDXB  #GymNationUAE #ThePeoplesGym  #dubai  #dubaigyms  #dxb #dxbfitness  #fitnessindxb  #mydubai #fitdubai  #dubaifitness  #dubaifit  #mydxb #dubaifitfam  #fitness  #dubailife  #dubaifitfamily  #dubaigym #dubaievents #dubaimuscleshow #dubaiactiveshow2018

276 likes - 276 comments
Good people will bring out the Magic🌟 in you, not the madness. Happy 23rd Birthday Ms. Sydney! 🦄🧁✨#bsfteammoments.
.
.
There are few people that can brighten the entire room with their smile: Sydney can. We hope you have an awesome birthday. Be sure to extend the festivities as long as you can - turning 23 only happens once a lifetime😆😉.
.
Thank you @maggiee.geee for always thinking of others. Your heart shines all over this photo and we are so grateful for your generosity and giving to others ❤️🌟.
.
Without meaning any disrespect to past employees, we truly feel we have the best team right now. We are excited for all that’s to come in 2019 for BSF and everyone included! 💪🏼🔥 #bigplansahead.
.
.
#birthdaygirlselfie #bestteamever #bsffam #bsfteam #bsfgoals.
.
#differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym.
.
#bsf #bsffitness #bsffitnesscenter #venturaca #venturastrong.
.
@physique_4life 
@linzfit23 
@addicted2gainzzz 
@joey_thabeast 
@maggiegee___ 
@sydd_renee 
@alexismmxo 
@_dam_renas

Good people will bring out the Magic🌟 in you, not the madness. Happy 23rd Birthday Ms. Sydney! 🦄🧁✨#bsfteammoments. . . There are few people that can brighten the entire room with their smile: Sydney can. We hope you have an awesome birthday. Be sure to extend the festivities as long as you can - turning 23 only happens once a lifetime😆😉. . Thank you @maggiee.geee for always thinking of others. Your heart shines all over this photo and we are so grateful for your generosity and giving to others ❤️🌟. . Without meaning any disrespect to past employees, we truly feel we have the best team right now. We are excited for all that’s to come in 2019 for BSF and everyone included! 💪🏼🔥 #bigplansahead. . . #birthdaygirlselfie #bestteamever #bsffam #bsfteam #bsfgoals. . #differentbreed #bestmembersever #championsbledhere #championsbredhere #jointhemovement #thepeoplesgym. . #bsf #bsffitness #bsffitnesscenter #venturaca #venturastrong. . @physique_4life @linzfit23 @addicted2gainzzz @joey_thabeast @maggiegee___ @sydd_renee @alexismmxo @_dam_renas

94 likes - 94 comments
We love having @mel_smellons as part of the Revolution family! 💙

We love having @mel_smellons as part of the Revolution family! 💙

40 likes - 40 comments